Protein coding transcript 105491

• Transcript: Ll_transcript_380513
• CDS coordinates: 2-418 (+)
• Peptide sequence: FLAEKPRSPFAKFCRVKYLKLVHSKMESSFFGNLSQRSILNAGGFPDTAFFASFAEMAKRVWLLHCLAFSFEPHASMFQVEKGCRFSDVYMESVNDEMFLHSDETVESEPHVAFTVVPGFRIGKTVIQCQVYLSQHQTK
• ORF Type: internal

Annotations of Ll_transcript_380513

• Blastp: Protein GRAVITROPIC IN THE LIGHT 1 from Arabidopsis with 43.94% of identity
• Blastx: Protein GRAVITROPIC IN THE LIGHT 1 from Arabidopsis with 43.94% of identity
• Eggnog: Plant protein of unknown function (DUF641)(ENOG410YCXF)
• Kegg: Link to kegg annotations (AT5G58960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019426272.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;