Protein coding transcript 105507

• Transcript: Ll_transcript_380284
• CDS coordinates: 265-765 (+)
• Peptide sequence: MDDYVISDDDYQYSDDQDDSVEAYENDETDYQLITSKGPNTQVITKESLLAAQREDLRRVMDMLSVKEQHARTLLIYHCWDVEKLFAVYVDKGISHLFAEAGVTMDKHHHSDSSFRSLIMCEICMEDVPIDEATGMDCGHSFCNTCEDLFVFLFIRLLSPPRFIRI*
• ORF Type: complete

Annotations of Ll_transcript_380284

• Blastp: Probable E3 ubiquitin-protein ligase ARI1 from Arabidopsis with 55.41% of identity
• Blastx: Probable E3 ubiquitin-protein ligase ARI1 from Arabidopsis with 59.06% of identity
• Eggnog: RING finger) protein(ENOG410XP9Y)
• Kegg: Link to kegg annotations (AT4G34370)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454167.1)
• Pfam: RING-type zinc-finger (PF13445.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;