Transcript | Ll_transcript_380284 |
---|---|
CDS coordinates | 265-765 (+) |
Peptide sequence | MDDYVISDDDYQYSDDQDDSVEAYENDETDYQLITSKGPNTQVITKESLLAAQREDLRRVMDMLSVKEQHARTLLIYHCWDVEKLFAVYVDKGISHLFAEAGVTMDKHHHSDSSFRSLIMCEICMEDVPIDEATGMDCGHSFCNTCEDLFVFLFIRLLSPPRFIRI* |
ORF Type | complete |
Blastp | Probable E3 ubiquitin-protein ligase ARI1 from Arabidopsis with 55.41% of identity |
---|---|
Blastx | Probable E3 ubiquitin-protein ligase ARI1 from Arabidopsis with 59.06% of identity |
Eggnog | RING finger) protein(ENOG410XP9Y) |
Kegg | Link to kegg annotations (AT4G34370) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454167.1) |
Pfam | RING-type zinc-finger (PF13445.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer