Protein coding transcript 105555

• Transcript: Ll_transcript_382086
• CDS coordinates: 1025-2119 (+)
• Peptide sequence: MSRQYLVFGELLETSAITTQSFLPVISSTKPLSDWEYYPAFYYQLAAHYLSEKRSALELAISMSETSTEIDSGADSVVPSVYVGQFARLIEQGDNVDMLPITDEEYTRFAVSEGRRFRDSLEIIALQKKAYESYSSMKIDRMSSYCGFQMAKEYFIEGDIDNAKQVFDGIASLYRKEGWVTLLWDVLGYLRECSRKNGVVKDFVEYSLEMAALPITSDIGVQRDTGPAGPANLLQRETIHKEVFNLVTDAAGLATNEHLSNLKFTGGESLQLEVDLVSPLRLVMLASVAFHEPAIKPGTSTLITVSLLSHLPITIEIDQLEIQFKQSDCNFFIANAQKPRSIEVSDVQQHRVETVPSISLESNKW
• ORF Type: 3prime_partial

Annotations of Ll_transcript_382086

• Blastp: Trafficking protein particle complex subunit 11 from Mus with 24.7% of identity
• Blastx: Trafficking protein particle complex subunit 11 from Bos with 25.79% of identity
• Eggnog: trafficking protein particle complex(ENOG410XSTE)
• Kegg: Link to kegg annotations (320714)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019421004.1)
• Pfam: Foie gras liver health family 1 (PF11817.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;