Protein coding transcript 105576

• Transcript: Ll_transcript_380798
• CDS coordinates: 600-1184 (+)
• Peptide sequence: MEDNKLAALNQLRNIFGFGKREAEAVSLDVTSKVYRKRLGQAVSSGELEVADSKAKFLQNLCDELHFDPQKASELHEEIYRQKLQQLVAGGELSEEDVAALLRLRVMLCIPQQTVEAVHSDICGSLFEKVVKEAIASGVDGYDADIKESVRKSAHGLRLTRETAMTIAGKAVRKIFINYIKRARAAGSRTESAKE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_380798

• Blastp: Protein TIC110, chloroplastic from Pisum with 78.97% of identity
• Blastx: Protein TIC110, chloroplastic from Pisum with 78.2% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461129.1)
• Pfam: Chloroplast envelope transporter (PF16940.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;