Transcript | Ll_transcript_277579 |
---|---|
CDS coordinates | 2-451 (+) |
Peptide sequence | FGALVFGYFLDLARFRRTVRAKACWVVLFLLTFGVWGGGYAFQRGYTRAEVEMGADTPDDPSDDYPKYDWTDSGYIGPMFLYIFYGFYDAAWQCSVYWFMGAMTNNSRKLANYSGFYKGIQSAGAAVIWRLDGLKISYMSEFASSWGLLA |
ORF Type | internal |
Blastp | - |
---|---|
Blastx | UNC93-like protein C922.05c from Schizosaccharomyces with 47.3% of identity |
Eggnog | - |
Kegg | Link to kegg annotations (SPAC922.05c) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_017420601.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer