Protein coding transcript 105653

• Transcript: Ll_transcript_380597
• CDS coordinates: 926-1408 (+)
• Peptide sequence: MFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPNKEEFHQETCRKIKALHQYDCQRANKSTFAWGLEARVPFLDKEFINVAMNIDPEHKMIKRDEGRIEKWVLRKAFDDEEHPYLPKHILYRQKEQFSDGVGYGWIDGLKAHAAKHVLNPTFLCTIQ*
• ORF Type: complete

Annotations of Ll_transcript_380597

• Blastp: Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 91.67% of identity
• Blastx: Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 91.87% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461456.1)
• Pfam: Asparagine synthase (PF00733.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;