Transcript | Ll_transcript_380598 |
---|---|
CDS coordinates | 196-708 (+) |
Peptide sequence | MTDVPFGVLLSGGLDSSLVASITSRYLGTTKAAKQWGSKLHSFCVGLEGSPDLKAAQEVADYLGTVHHEFQYTVQDGLDAIGDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPNKEEFHQETCRKIKALHQYDCQRANKSTFAWGLE |
ORF Type | 3prime_partial |
Blastp | Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 93.57% of identity |
---|---|
Blastx | Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 77.97% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019456252.1) |
Pfam | Asparagine synthase (PF00733.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer