Protein coding transcript 105654

• Transcript: Ll_transcript_380598
• CDS coordinates: 196-708 (+)
• Peptide sequence: MTDVPFGVLLSGGLDSSLVASITSRYLGTTKAAKQWGSKLHSFCVGLEGSPDLKAAQEVADYLGTVHHEFQYTVQDGLDAIGDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPNKEEFHQETCRKIKALHQYDCQRANKSTFAWGLE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_380598

• Blastp: Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 93.57% of identity
• Blastx: Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 77.97% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019456252.1)
• Pfam: Asparagine synthase (PF00733.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;