Protein coding transcript 105659

• Transcript: Ll_transcript_380605
• CDS coordinates: 3-899 (+)
• Peptide sequence: RKQLPNHKFRTGSDCDVIAHLYEEHGENFVDMLDGIFSFVLLDTRDNSYIVARDAIGVTSLYIGWGLDGSVWISSEMKGLNDDCEHFEVFPPGHLYSSRESGFRRWYNPPWFSQAIPSAPYDPLALRHAFEKAVIKRLMTDVPFGVLLSGGLDSSLVASITSRYLATTKAAEQWGSKLHSFCVGLEGSPDLKAGKEVADYLGTVHHEFQYTVQDGLDAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPNKEEFHQETCRKVIILSCSNVKG*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_380605

• Blastp: Asparagine synthetase [glutamine-hydrolyzing] 1 from Lotus with 93.47% of identity
• Blastx: Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 93.13% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000283)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461456.1)
• Pfam: Glutamine amidotransferase domain (PF13522.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;