Protein coding transcript 105662

• Transcript: Ll_transcript_380589
• CDS coordinates: 3-581 (+)
• Peptide sequence: RKQLPNHKFRTGSDCDVIAHLYEEHGENFVDMLDGIFSFVLLDTRDNSYIVARDAIGVTSLYIGWGLDGSVWISSEMKGLNDDCEHFEVFPPGHLYSSRESGFRRWYNPPWFSQAIPSAPYDPLALRHAFEKAVIKRLMTDVPFGVLLSGGLDSSLVASITSRYLATTKAAEQWGSKLHSFCVGLEVNISSQ*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_380589

• Blastp: Asparagine synthetase [glutamine-hydrolyzing] 1 from Lotus with 94.62% of identity
• Blastx: Asparagine synthetase [glutamine-hydrolyzing] 1 from Lotus with 94.62% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461456.1)
• Pfam: Glutamine amidotransferase domain (PF13522.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;