Transcript | Ll_transcript_380593 |
---|---|
CDS coordinates | 537-1229 (+) |
Peptide sequence | MTDVPFGVLLSGGLDSSLVASITSRYLATTKAAEQWGSKLHSFCVGLEGSPDLKAGKEVADYLGTVHHEFQYTVQDGLDAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPNKEEFHQETCRKIKALHQYDCQRANKSTFAWGLEARVPFLDKEFINVAMNIDPEHKMIKRDEGRIEKWVLRRAFDDEEHPYLPKVLCNLLQYV* |
ORF Type | complete |
Blastp | Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 94.57% of identity |
---|---|
Blastx | Asparagine synthetase [glutamine-hydrolyzing] 1 from Lotus with 78.92% of identity |
Eggnog | - |
Kegg | - |
CantataDB | Link to cantataDB annotations (CNT0000283) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461456.1) |
Pfam | Asparagine synthase (PF00733.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer