Protein coding transcript 105663

• Transcript: Ll_transcript_380593
• CDS coordinates: 537-1229 (+)
• Peptide sequence: MTDVPFGVLLSGGLDSSLVASITSRYLATTKAAEQWGSKLHSFCVGLEGSPDLKAGKEVADYLGTVHHEFQYTVQDGLDAIEDVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKWVISGEGSDEIFGGYLYFHKAPNKEEFHQETCRKIKALHQYDCQRANKSTFAWGLEARVPFLDKEFINVAMNIDPEHKMIKRDEGRIEKWVLRRAFDDEEHPYLPKVLCNLLQYV*
• ORF Type: complete

Annotations of Ll_transcript_380593

• Blastp: Asparagine synthetase, root [glutamine-hydrolyzing] from Pisum with 94.57% of identity
• Blastx: Asparagine synthetase [glutamine-hydrolyzing] 1 from Lotus with 78.92% of identity
• Eggnog: -
• Kegg: -
• CantataDB: Link to cantataDB annotations (CNT0000283)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461456.1)
• Pfam: Asparagine synthase (PF00733.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;