Transcript | Ll_transcript_379945 |
---|---|
CDS coordinates | 285-806 (+) |
Peptide sequence | MRELKSILYGDSETEPVPEACSQLTQEFFKDNTMQLLIISLPKFNLETRKDATQVVANLQRQQVQYKLIASDYLEANMGLIDILISGYEDTNMTLHYGAMLRECIRHQIVAKYVLESPHMKKFFYYIQLPNFDIAADAAATFKELLTRHKSTVAEFLSNNYEWVGSTFSFRLK* |
ORF Type | complete |
Blastp | Putative MO25-like protein At5g47540 from Arabidopsis with 75.58% of identity |
---|---|
Blastx | Putative MO25-like protein At5g47540 from Arabidopsis with 69.23% of identity |
Eggnog | Calcium binding protein(ENOG410XP4S) |
Kegg | Link to kegg annotations (AT5G47540) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019434915.1) |
Pfam | Mo25-like (PF08569.10) |
Rfam | - |
GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer