Transcript | Ll_transcript_470585 |
---|---|
CDS coordinates | 83-802 (+) |
Peptide sequence | MSQLNGAYYGPAIPPPPPPRYYHRSDERGCCCNCLCGITKCCCGCIFSIICKIITFFLVLAIIVGVIIWLIVRPNPLKFHVTEANLTEFNYGNNEILDYDLALNVSIRNPNSRLGVYYDEIETTALYDDVKFGSQTLEPFFQRRKTTSYLGPVFKGKQVMSLGENQVSKLNKDKESGVYHIVVKLKMKFRFKFGLIKIGNINPKIRCDLKVPLKSHNGTGQFETTECGWDYRSFFLRKE* |
ORF Type | complete |
Blastp | NDR1/HIN1-like protein 2 from Arabidopsis with 44.59% of identity |
---|---|
Blastx | NDR1/HIN1-like protein 3 from Arabidopsis with 48.07% of identity |
Eggnog | harpin-induced protein 1 domain containing protein, expressed(ENOG410YGQV) |
Kegg | Link to kegg annotations (AT3G11650) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433866.1) |
Pfam | Late embryogenesis abundant protein (PF03168.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer