Protein coding transcript 105741

• Transcript: Ll_transcript_380320
• CDS coordinates: 251-676 (+)
• Peptide sequence: MEENIICQWSVFRSLLAILQWWTFNVTVIIMNKWIFQKLEFKFPLSVSCIHFICSSIGAYVVIKMLKLKPLIHVDPEDRWRRIFPMSFVFCINIVLGNVSLRYIPVSFMQTIKSFTPATTGRFNNWLHLCHLFNVEISWTL*
• ORF Type: complete

Annotations of Ll_transcript_380320

• Blastp: UDP-galactose transporter 1 from Arabidopsis with 89.17% of identity
• Blastx: UDP-galactose transporter 1 from Arabidopsis with 89.17% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT1G77610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430579.1)
• Pfam: Triose-phosphate Transporter family (PF03151.15)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;