Transcript | Ll_transcript_432824 |
---|---|
CDS coordinates | 45-617 (+) |
Peptide sequence | MASTQGQIITCKAAVAWEPNKPLTIEDVQVAPPQAGEVRVKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVKPGDHVIPCYQAECGECKFCKSGKTNLCGKVRSATGVGVMLNDRKSRFSLNGKPLYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPTGKHLPLIT* |
ORF Type | complete |
Blastp | Alcohol dehydrogenase class-3 from Arabidopsis with 92.27% of identity |
---|---|
Blastx | Alcohol dehydrogenase class-3 from Arabidopsis with 92.27% of identity |
Eggnog | alcohol dehydrogenase(COG1062) |
Kegg | Link to kegg annotations (AT5G43940) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019425929.1) |
Pfam | Alcohol dehydrogenase GroES-like domain (PF08240.11) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer