Protein coding transcript 105752

• Transcript: Ll_transcript_380312
• CDS coordinates: 3614-4072 (+)
• Peptide sequence: MAPFATMILAIPAMLLEGNGILEWLSIHPYPWSALIIIVTSGVMAFCLNFSIFYVIHSTTAVTFNVAGNLKVAAAVLVSWLIFKNPISYLNAVGCAVTLVGCTFYGYVRHMISQQPPVPGTPRTPRTPRTPRTPLSKMELLPLVNDKLDDKV*
• ORF Type: complete

Annotations of Ll_transcript_380312

• Blastp: UDP-galactose transporter 1 from Arabidopsis with 80.39% of identity
• Blastx: UDP-galactose transporter 1 from Arabidopsis with 94.19% of identity
• Eggnog: solute carrier family 35 member(ENOG410XP1S)
• Kegg: Link to kegg annotations (AT1G77610)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019430579.1)
• Pfam: EamA-like transporter family (PF00892.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;