Protein coding transcript 10578

• Transcript: Ll_transcript_432828
• CDS coordinates: 45-617 (+)
• Peptide sequence: MASTQGQIITCKAAVAWEPNKPLTIEDVQVAPPQAGEVRVKILYTALCHTDAYTWSGKDPEGLFPCILGHEAAGIVESVGEGVTEVKPGDHVIPCYQAECGECKFCKSGKTNLCGKVRSATGVGVMLNDRKSRFSLNGKPLYHFMGTSTFSQYTVVHDVSVAKIDPKAPLEKVCLLGCGVPTGKHLPLIT*
• ORF Type: complete

Annotations of Ll_transcript_432828

• Blastp: Alcohol dehydrogenase class-3 from Arabidopsis with 92.27% of identity
• Blastx: Alcohol dehydrogenase class-3 from Arabidopsis with 92.27% of identity
• Eggnog: alcohol dehydrogenase(COG1062)
• Kegg: Link to kegg annotations (AT5G43940)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425929.1)
• Pfam: Alcohol dehydrogenase GroES-like domain (PF08240.11)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;