Transcript | Ll_transcript_470582 |
---|---|
CDS coordinates | 75-677 (+) |
Peptide sequence | MSSSYFGEQNMGNEKGSGSSSSSSSSSKKGKKSNSDKPKQPQRGLGVAQLEKIRLHGQMAYHPSLHSPYPSNFSDEDPRMQIPYSSVPSSSSFSYSSSSTSYSPSYGFQPNIVMGLPEYEKSNIRYGDSQPTNTARWENANTSFDNQSPAESNITRPFLNLHDSQDIDAVRQRSGSGRSRSQNSESSDTQELDLELKLSL* |
ORF Type | complete |
Blastp | Protein SPEAR1 from Arabidopsis with 44.33% of identity |
---|---|
Blastx | Protein SPEAR3 from Arabidopsis with 44% of identity |
Eggnog | NA(ENOG410Z28R) |
Kegg | Link to kegg annotations (AT2G20080) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019447703.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer