Protein coding transcript 105826

• Transcript: Ll_transcript_381764
• CDS coordinates: 1421-1909 (+)
• Peptide sequence: MAQGSLFTWVNDDVFRKPTFSRFLSLLDNYNPHQGSKEVVTSEEKQEQASFIEEISRTAPIKYLHKYLASKGIASGSYQDFKRMMTSLWFDLYGRGGTSGSSSAFEHVFVGEIKQNNQVSGFHNWLQVRPPASFFCLLGSIWVRANIVGGGGSCPHWNLNFS*
• ORF Type: complete

Annotations of Ll_transcript_381764

• Blastp: Poly(U)-specific endoribonuclease-B from Danio with 44.35% of identity
• Blastx: Poly(U)-specific endoribonuclease-B from Danio with 42.69% of identity
• Eggnog: Poly(U)-specific(ENOG410XX8E)
• Kegg: Link to kegg annotations (553584)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446023.1)
• Pfam: Endoribonuclease XendoU (PF09412.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;