Protein coding transcript 105834

• Transcript: Ll_transcript_381750
• CDS coordinates: 138-614 (+)
• Peptide sequence: MNMFASFTKPFAFPSCSVRADSEFGTKPNSLKPSSSSSSLHFQPHPLASKIVVKNLPYSTGETTLQKEFSNFGKIAEVKVVKDVITKRSKGFAFIQYTSQDDAMLALETMDQKVFHGRTICVEIATLGRDDFGARPKTSGPPKKWNLPQQEETVDCWY*
• ORF Type: complete

Annotations of Ll_transcript_381750

• Blastp: Serine/arginine-rich splicing factor 2 from Gallus with 33.33% of identity
• Blastx: Serine/arginine-rich splicing factor 2 from Gallus with 33.33% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (396195)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019460064.1)
• Pfam: RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) (PF13893.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;