Protein coding transcript 105907

• Transcript: Ll_transcript_380553
• CDS coordinates: 280-606 (+)
• Peptide sequence: MFLCSALGQAAPNIGSIAKGRAAAANIMNMIASVSKTSEGLDDGTVLPQVAGKIDFFEVCFAYPSRSNMVFENLSFSVSAGKTIAVVGPSGSGKSTIISMIQRFYGPTS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_380553

• Blastp: ABC transporter B family member 13 from Arabidopsis with 67.62% of identity
• Blastx: ABC transporter B family member 13 from Arabidopsis with 67.62% of identity
• Eggnog: (ABC) transporter(COG1132)
• Kegg: Link to kegg annotations (AT1G27940)
• CantataDB: Link to cantataDB annotations (CNT0002793)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433881.1)
• Pfam: ABC transporter (PF00005.26)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;