Protein coding transcript 106024

• Transcript: Ll_transcript_381700
• CDS coordinates: 2-349 (+)
• Peptide sequence: SLIILFNALHSSYQPHQNMKNLCFSVFLFLFLYTAFFTLVFGANVSYDGRSLIIDGQRKLLLSASIHYPRSVPAMWPGLVKAAKEGGIDVIETYVFWNGHELSPGKYYFGGRFNLV
• ORF Type: internal

Annotations of Ll_transcript_381700

• Blastp: Beta-galactosidase 4 from Arabidopsis with 60.87% of identity
• Blastx: Beta-galactosidase 4 from Arabidopsis with 72.97% of identity
• Eggnog: beta-galactosidase(COG1874)
• Kegg: Link to kegg annotations (AT5G56870)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019414387.1)
• Pfam: Glycosyl hydrolases family 35 (PF01301.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;