Transcript | Ll_transcript_382529 |
---|---|
CDS coordinates | 318-1319 (+) |
Peptide sequence | MDMRIGRRVSRGMLPLLALQTFSEYYRSERKPPITAALIAANTLIYLRPAFLEPFIPPIDEVWFNPHLILKYKDLKRFFLSPFYHIGEPHLVYNMLSLLWKGFQLETAIGSVEFASMVASLLALSQGITLMLSKSLLLFFDYERAYYNEYAVGFSGVLFAMKVVLNARSEDYSYVHGVIVPSRYAAWAELVLIQMLVPGVSFLGHLGGVLAGLLYLRLKGTNSGSNPLTILIRGLTRAANWPLKFLRHLFRFQRGRISGRGTVGGNRAGNTAQSGVWRCQACTYDNPDLLTLCEMCGTGRTGNGLSSLQWNHDSDDIPLDELRRRRINRFGRW* |
ORF Type | complete |
Blastp | Rhomboid-like protein 14, mitochondrial from Arabidopsis with 65.85% of identity |
---|---|
Blastx | Rhomboid-like protein 14, mitochondrial from Arabidopsis with 65.62% of identity |
Eggnog | Rhomboid domain containing(ENOG41100KJ) |
Kegg | Link to kegg annotations (AT3G17611) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019455576.1) |
Pfam | Rhomboid family (PF01694.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer