Protein coding transcript 1061

• Transcript: Ll_transcript_477483
• CDS coordinates: 264-575 (+)
• Peptide sequence: MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHARRKTVTAMDVVYALKRQGRTLYGFGG*
• ORF Type: complete

Annotations of Ll_transcript_477483

• Blastp: Histone H4 from Soja with 100% of identity
• Blastx: Histone H4 from Soja with 100% of identity
• Eggnog: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling(COG2036)
• Kegg: Link to kegg annotations (100305586)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_007162656.1)
• Pfam: Centromere kinetochore component CENP-T histone fold (PF15511.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;