Transcript | Ll_transcript_380474 |
---|---|
CDS coordinates | 2-844 (+) |
Peptide sequence | GGSSSSSSRSQMKLWMIRATTSIMLWTCIVQLTALGDMWGPRVLKGWPSCFTHDSAIVALDSHFPTPPHVFLPPKRVYKNNGYLMVSCNGGLNQMRAAICDMVAIARYLNVTLIVPELDKASFWADPSEFQDIFDVDHFIASLRDEVRILKELPPRLKLRVENEPLYTMPPISWSDISYYQNQILPLMQKYKVVHLNRTDARLSNNNLPLEIQKLRCRVNFSALRFTPEIEELGRKVINLLRQNGPFLVLHLRYEMDMLAFSGCTQGCNSEEVEELTRMR* |
ORF Type | 5prime_partial |
Blastp | Uncharacterized protein At1g04910 from Arabidopsis with 43.06% of identity |
---|---|
Blastx | Uncharacterized protein At1g04910 from Arabidopsis with 43.06% of identity |
Eggnog | DUF246 domain-containing protein(ENOG410Z25U) |
Kegg | Link to kegg annotations (AT1G04910) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019451847.1) |
Pfam | GDP-fucose protein O-fucosyltransferase (PF10250.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer