Transcript | Ll_transcript_380201 |
---|---|
CDS coordinates | 1442-1864 (+) |
Peptide sequence | MFLIHWQVSDKMDPKELVRLIEILNPQNKAGRITIITRMGAENMRVKLPHLIRAVRGAGQIVTWVSDPMHGNTIKAPCGLKTRPFDAIMVCNFFNSPAHDLPIPPSGNKARSLLLSSLLIVYKCLPHSFKYVHVWIKISL* |
ORF Type | complete |
Blastp | Phospho-2-dehydro-3-deoxyheptonate aldolase 2, chloroplastic from Lycopersicon with 84.38% of identity |
---|---|
Blastx | Phospho-2-dehydro-3-deoxyheptonate aldolase 1, chloroplastic from Nicotiana with 95.79% of identity |
Eggnog | phospho-2-dehydro-3-deoxyheptonate aldolase(COG3200) |
Kegg | Link to kegg annotations (544153) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019430963.1) |
Pfam | Class-II DAHP synthetase family (PF01474.15) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer