Transcript | Ll_transcript_298936 |
---|---|
CDS coordinates | 456-1388 (+) |
Peptide sequence | MYNGGWSDGESHDRQQRRIPPPSSMPWVRNLRRFIGSGAGLGSEALMGHFYSLSLSQSHRFPFLLSYYSQTLTHAILYYLVHFHFPELETKRILLHIFNEKQKKSAEAGTIPSFYKKKPEDGSISHRVQRLAKYRFLKKQSDILLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDEQGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLLQHEMEAYIRGLIPNLAQLRDMPAAFVQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELME |
ORF Type | 3prime_partial |
Blastp | Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 from Arabidopsis with 77.56% of identity |
---|---|
Blastx | Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 from Arabidopsis with 77.56% of identity |
Eggnog | Protein phosphatase 2, regulatory subunit B(ENOG410XRBK) |
Kegg | Link to kegg annotations (AT5G18580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019464806.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer