Protein coding transcript 106232

• Transcript: Ll_transcript_298937
• CDS coordinates: 381-791 (+)
• Peptide sequence: MEAYIRGLIPNLAQLRDMPAAFVQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELMELHQESEEEVTDTEQAENWFSLTSAQRICDMFLALDKDANGTLSKQELQEYADGTLTEIFIERGSIYYNSSVIMV*
• ORF Type: complete

Annotations of Ll_transcript_298937

• Blastp: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 from Arabidopsis with 89.52% of identity
• Blastx: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 from Arabidopsis with 89.6% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XRBK)
• Kegg: Link to kegg annotations (AT5G18580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019437687.1)
• Pfam: EF hand (PF13202.5)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;