Protein coding transcript 106235

• Transcript: Ll_transcript_298946
• CDS coordinates: 456-1271 (+)
• Peptide sequence: MYNGGWSDGESHDRQQRRIPPPSSMPWVRNLRRFIGSGAGLGSEALMELETKRILLHIFNEKQKKSAEAGTIPSFYKKKPEDGSISHRVQRLAKYRFLKKQSDILLNADDLDAMWVCLRENCVIDDATGAEKMNYEDFCHIASVCTEQIGPKCRRFFSPSNFMKFEKDEQGRIAILPFYLYVMRTVSLTQARIDMSELDEDSDGFLLQHEMEAYIRGLIPNLAQLRDMPAAFVQMYCRIAAHKFFFFCDPHRRGKACIKKVLLSNCLQELME
• ORF Type: 3prime_partial

Annotations of Ll_transcript_298946

• Blastp: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 from Arabidopsis with 88.64% of identity
• Blastx: Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 from Arabidopsis with 88.64% of identity
• Eggnog: Protein phosphatase 2, regulatory subunit B(ENOG410XRBK)
• Kegg: Link to kegg annotations (AT5G18580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464806.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;