Protein coding transcript 106287

• Transcript: Ll_transcript_300263
• CDS coordinates: 1-495 (+)
• Peptide sequence: FKFSRGHIGQYDSGSEDARFYNSSGYFDEFVWGGAWMYYATGNSTYLNFVTTPSVAQDAGNLVRGPNYGVLSWDNKLAGAQVLLSRLRLFLSPGYPYEEILRTFHNQTSIVMCSYLPVFTSFNRTKGGLIQLNHGRPQPLQYVVNAAFLAALYSDYLEAADTPGW
• ORF Type: internal

Annotations of Ll_transcript_300263

• Blastp: Endoglucanase 9 from Oryza sativa with 77.71% of identity
• Blastx: Endoglucanase 9 from Oryza sativa with 77.71% of identity
• Eggnog: endoglucanase(ENOG410XP0H)
• Kegg: Link to kegg annotations (4332724)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019442456.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;