Transcript | Ll_transcript_300870 |
---|---|
CDS coordinates | 137-478 (+) |
Peptide sequence | MNILRSFWNSPTGLKTTHFWGPTFNWSLPLAAAMDTKKPPETISINMTAVMCVYSALFMRFAWVVRPRNPHLLICHVSNETVQLYQLSRWLRAQRYKKMLLHCYSHTNGCWFK* |
ORF Type | complete |
Blastp | Mitochondrial pyruvate carrier 1 from Arabidopsis with 67.74% of identity |
---|---|
Blastx | Mitochondrial pyruvate carrier 1 from Arabidopsis with 67.74% of identity |
Eggnog | Brain protein 44-like(ENOG4111TU9) |
Kegg | Link to kegg annotations (AT5G20090) |
CantataDB | Link to cantataDB annotations (CNT0000099) |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019438676.1) |
Pfam | Uncharacterised protein family (UPF0041) (PF03650.12) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer