Protein coding transcript 106362

• Transcript: Ll_transcript_300887
• CDS coordinates: 150-473 (+)
• Peptide sequence: MNILRSFWNSPTGLKTTHFWGPTFNWSLPLAAAMDTKKPPETISINMTAVMCVYSALFMRFAWVVRPRNPHLLICHVSNETVQLYQLSRWLRAQRNPEVKKEEDGAE*
• ORF Type: complete

Annotations of Ll_transcript_300887

• Blastp: Mitochondrial pyruvate carrier 1 from Arabidopsis with 65.35% of identity
• Blastx: Mitochondrial pyruvate carrier 1 from Arabidopsis with 65.35% of identity
• Eggnog: Brain protein 44-like(ENOG4111TU9)
• Kegg: Link to kegg annotations (AT5G20090)
• CantataDB: Link to cantataDB annotations (CNT0000099)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438676.1)
• Pfam: Uncharacterised protein family (UPF0041) (PF03650.12)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;