Transcript | Ll_transcript_300600 |
---|---|
CDS coordinates | 753-1505 (+) |
Peptide sequence | MGKRKMNESDSDYSSGEENDDEGVKEKSVILNSQNESDSNKDEGSSGSVTDNKQQGVDSSGAGSCESGSEEEKKTVVEVKAESIGPQSADTDQVELGNAVEPVLCDEMVKPAAVVYSESVVSGFSAEDNGHHDANGIVSDKLDGSLSLASNITGSENVNGAIKCMEVVRENKTSVNEETSPSIPTLEEPLNFDAFSSAAELEVLGMERLKSELQSRGLKCGGALQERAARLFLLKSTPLDKLPKKLLAKK* |
ORF Type | complete |
Blastp | Protein SDE2 homolog from Danio with 50.65% of identity |
---|---|
Blastx | Protein SDE2 homolog from Danio with 55% of identity |
Eggnog | SDE2 telomere maintenance homolog (S. pombe)(ENOG4111WBQ) |
Kegg | Link to kegg annotations (550448) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019424115.1) |
Pfam | Telomere stability C-terminal (PF13297.5) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer