Protein coding transcript 106413

• Transcript: Ll_transcript_300290
• CDS coordinates: 1-333 (+)
• Peptide sequence: KRTRQEVESSTIMERALTASNLNTSFIPSRQFHSTKSVSTFVLPSSISITNPIRSSMKSYHLSHLTHPQLQSLKSRPRIDFSSIFNLVRNGSSQFFIFIHFIQMGFCFSL*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_300290

• Blastp: Histidinol dehydrogenase, chloroplastic from Brassica with 63.89% of identity
• Blastx: Histidinol dehydrogenase, chloroplastic from Brassica with 63.89% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019425544.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;