Transcript | Ll_transcript_298409 |
---|---|
CDS coordinates | 148-528 (+) |
Peptide sequence | MKRNCTLDLRFHSSSSYSLPHNSTNEPLNISKQLLHAILHKRSHTLDITELQARMIIWLAKQEMEEIKNGGTRTNNPMPLFSLQLHALLMHLPQGISIKKSIKSFLHKRKKRFQTHIDIATQSNTN* |
ORF Type | complete |
Blastp | Protein JAZ13 from Arabidopsis with 29.82% of identity |
---|---|
Blastx | - |
Eggnog | NA(ENOG41108DA) |
Kegg | Link to kegg annotations (AT3G22275) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019436137.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer