Transcript | Ll_transcript_283587 |
---|---|
CDS coordinates | 150-1079 (+) |
Peptide sequence | MVFPRGGGGSGGGFRGRGGGGGDRGRGRGFGGGRGGGRGGTPFKARGGGRGGGRGGRGGGRGGGMKGGNKVVVEPHRHEGIFIAKGKEDALVTKNLVPGEAVYNEKRITVQKEDGSKEEYRIWNPFRSKLAAAILGGVDNIWIKPGARVLYLGAASGTTVSHVSDIVGPTGVVYAVEFSHRSGRDLVNMAKKRTNVIPIIEDARHPAKYRMLVGIVDVIFSDVAQPDQARILGLNASYYLKSGGHFVISIKANCIDSTVPAETVFASEVNKLKADQFKPFEQVTLEPFERDHACVVGGYRVPKKKKDAE* |
ORF Type | complete |
Blastp | Mediator of RNA polymerase II transcription subunit 36a from Arabidopsis with 88.93% of identity |
---|---|
Blastx | Mediator of RNA polymerase II transcription subunit 36a from Arabidopsis with 88.75% of identity |
Eggnog | Involved in pre-rRNA and tRNA processing. Utilizes the methyl donor S-adenosyl-L-methionine to catalyze the site-specific 2'-hydroxyl methylation of ribose moieties in rRNA and tRNA. Site specificity is provided by a guide RNA that base pairs with the substrate. Methylation occurs at a characteristic distance from the sequence involved in base pairing with the guide RNA (By similarity)(COG1889) |
Kegg | Link to kegg annotations (AT4G25630) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448854.1) |
Pfam | Fibrillarin (PF01269.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer