Protein coding transcript 1066

• Transcript: Ll_transcript_448731
• CDS coordinates: 55-1098 (+)
• Peptide sequence: MVHLLMERLVMAIMILCVSRVPMLATAEPKFPALFAFGDSILDTGNNNKIISIIKANFRPYGLIYNEGKPTGRFSDGKVPSDLLAGALGIKDALPPYYRNKNLDDKELPTGVCFASGGAGYDNKTSQFVRILSLYDQLNLFKEYKAKLAESVGQEKANEIVAKSLYIVSAGNNDIAITYTRLTRRMPFNEYAGLLVDWTATFAKDLYELGARHLWVFSALPLGCMPIGRSLVGGKQCNGIWNEFATEYNTLLQQNITSFKTATPDYDLQYIDIFNSLNNIVQSYAQLGYESPVNCCGGKSFGLGELCSALTGTCKNSSKHVFWDFAHPTQRTYEILVDEMVKKHVPN*
• ORF Type: complete

Annotations of Ll_transcript_448731

• Blastp: GDSL esterase/lipase At1g59406 from Arabidopsis with 39.42% of identity
• Blastx: GDSL esterase/lipase EXL3 from Arabidopsis with 41.5% of identity
• Eggnog: GDSL esterase lipase(COG3240)
• Kegg: Link to kegg annotations (AT1G58725)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019433877.1)
• Pfam: GDSL-like Lipase/Acylhydrolase (PF00657.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;