| Transcript | Ll_transcript_300718 |
|---|---|
| CDS coordinates | 114-509 (+) |
| Peptide sequence | MMEMDGQCYWIIELLRHLLRDRLSFLLSHSLRPLLLNGIIRYLFFQITSSVEVQCVIKFGLLQQKDGIRPFTMPLMRLACTALERVPLTRTKIIQHLMHKFNQDLVFVRAPDDSDLTSCVHGMVIHNFICL* |
| ORF Type | complete |
| Blastp | - |
|---|---|
| Blastx | ATP synthase mitochondrial F1 complex assembly factor 2 from Mus with 26.96% of identity |
| Eggnog | ATP synthase mitochondrial F1 complex assembly factor(COG5387) |
| Kegg | Link to kegg annotations (246782) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019458170.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer