Protein coding transcript 106666

• Transcript: Ll_transcript_300719
• CDS coordinates: 114-746 (+)
• Peptide sequence: MMEMDGQCYWIIELLRHLLRDRLSFLLSHSLRPLLLNGIIRYLFFQITSSVEVQCVIKFGLLQQKDGIRPFTMPLMRLACTALERVPLTRTKIIQHLMHKFNQDLVFVRAPDDSDLTSCVHDRQVEKIDPLLHWLESEFGFKPVVYSSIFGGKQEDGLVTAIENFLKKTDDCELATIDAIASAGHSLTIAIGMVLGKLQIEEAIELIRLEE
• ORF Type: 3prime_partial

Annotations of Ll_transcript_300719

• Blastp: ATP synthase mitochondrial F1 complex assembly factor 2 from Homo with 26.62% of identity
• Blastx: ATP synthase mitochondrial F1 complex assembly factor 2 from Homo with 35.14% of identity
• Eggnog: ATP synthase mitochondrial F1 complex assembly factor(COG5387)
• Kegg: Link to kegg annotations (91647)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458170.1)
• Pfam: ATP12 chaperone protein (PF07542.10)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;