Protein coding transcript 106669

• Transcript: Ll_transcript_299313
• CDS coordinates: 2461-2850 (+)
• Peptide sequence: MHRLVIPTGGGAVMRPINWKYMQKGVSVWLDVPVEALAQRIAAVGTNSRPLLHYEAGDAYTQAFKRLSALFEERSEAYANANTRVSLENIAAKLGQIDVSNLSPTAIAIEALEQIEGFVKGEDGCYTGS*
• ORF Type: complete

Annotations of Ll_transcript_299313

• Blastp: Shikimate kinase 1, chloroplastic from Arabidopsis with 69.67% of identity
• Blastx: Shikimate kinase 1, chloroplastic from Arabidopsis with 68.94% of identity
• Eggnog: Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate (By similarity)(COG0703)
• Kegg: Link to kegg annotations (AT2G21940)
• CantataDB: Link to cantataDB annotations (CNT0002940)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019463560.1)
• Pfam: Shikimate kinase (PF01202.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;