Transcript | Ll_transcript_299329 |
---|---|
CDS coordinates | 257-685 (+) |
Peptide sequence | MNAYAAQTSLQFSTFLLQQDKVGTRPCSSVILSHDPKNLRVIVSVKLQKQHHARALKIRRRTITPLEVSCSHDNIPASTLKSGSCRTPLDEELILKNKSQEVKPYLNGRCIYLVGMMGSGKTTVGKVMSQVLGYSFCDWLVW* |
ORF Type | complete |
Blastp | Shikimate kinase, chloroplastic from Lycopersicon with 45.58% of identity |
---|---|
Blastx | Shikimate kinase 1, chloroplastic from Arabidopsis with 57.72% of identity |
Eggnog | Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate (By similarity)(COG0703) |
Kegg | Link to kegg annotations (544078) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019463560.1) |
Pfam | Shikimate kinase (PF01202.21) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer