Protein coding transcript 106685

• Transcript: Ll_transcript_299330
• CDS coordinates: 89-517 (+)
• Peptide sequence: MNAYAAQTSLQFSTFLLQQDKVGTRPCSSVILSHDPKNLRVIVSVKLQKQHHARALKIRRRTITPLEVSCSHDNIPASTLKSGSCRTPLDEELILKNKSQEVKPYLNGRCIYLVGMMGSGKTTVGKVMSQVLGYSFCDWLVW*
• ORF Type: complete

Annotations of Ll_transcript_299330

• Blastp: Shikimate kinase, chloroplastic from Lycopersicon with 45.58% of identity
• Blastx: Shikimate kinase 1, chloroplastic from Arabidopsis with 68.99% of identity
• Eggnog: Catalyzes the specific phosphorylation of the 3-hydroxyl group of shikimic acid using ATP as a cosubstrate (By similarity)(COG0703)
• Kegg: Link to kegg annotations (544078)
• CantataDB: Link to cantataDB annotations (CNT0002940)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462478.1)
• Pfam: Shikimate kinase (PF01202.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;