Protein coding transcript 1067

• Transcript: Ll_transcript_448727
• CDS coordinates: 3-422 (+)
• Peptide sequence: QHPDENVVFAEFSKKCAERWKTMLDKEKKRFHEMAEKDKKRYDTEMQDYVPPVGEKRGKKRKQIKDPNAPKRSLSAFFWFCNDERGKVKSVNPEMTVGEIAKELGRRWSDISPELKNKYEQMAEKDKARYERDMTAYKKK
• ORF Type: internal

Annotations of Ll_transcript_448727

• Blastp: High mobility group protein DSP1 from Sophophora with 79.86% of identity
• Blastx: High mobility group protein DSP1 from Sophophora with 79.86% of identity
• Eggnog: high mobility group(COG5648)
• Kegg: Link to kegg annotations (Dmel_CG12223)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_013466118.1)
• Pfam: HMG-box domain (PF09011.9)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;