Protein coding transcript 106702

• Transcript: Ll_transcript_298169
• CDS coordinates: 473-976 (+)
• Peptide sequence: MMFQVNHFALEKMQHTENEEQKFNVRKLEISDKGKGFIELLQQLSVCDSVSNDEFEHRFQELSSLGEDHVICVIEDEVSGKIVATGSVFIEKKFLRNCGKVGHIEDVVVDSGIRGKQLGKKIINFLTDHAHSIGCYKVILDCSLDNKVFYEKCGFKQKEVQMVRYFI*
• ORF Type: complete

Annotations of Ll_transcript_298169

• Blastp: Glucosamine 6-phosphate N-acetyltransferase from Arabidopsis with 71.23% of identity
• Blastx: Glucosamine 6-phosphate N-acetyltransferase from Arabidopsis with 71.23% of identity
• Eggnog: acetyltransferase(COG0454)
• Kegg: Link to kegg annotations (AT5G15770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432915.1)
• Pfam: Acetyltransferase (GNAT) family (PF00583.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;