Protein coding transcript 106781

• Transcript: Ll_transcript_299486
• CDS coordinates: 413-1321 (+)
• Peptide sequence: MLADQMMNRIEYVHSKGFLHRDIKPDNFLMGLGRKANLVYIIDFGLAKRYRDSATNRHIPYRENKNLTGTARYASCNTHLGIEQSRRDDLESLGYVLLYFLRGSLPWQGLKAATKKQKYDKICEKKVSTPIEVLCKSHPVEFASYFHYCHSLIFDQRPDYGFLKRLFRDLFTREGYEFDYVFDWTILKYQQSQKNRVQPRISPVPGASNNHAMPMDLDNHRGDVSGRIRSSNATGSGVKIQFKSSVGKNLGSENPLGKNIFGEANVPSTSFSLAGTSRRTSLKPTMPTEAANHVHGQGSPFK*
• ORF Type: complete

Annotations of Ll_transcript_299486

• Blastp: Casein kinase 1-like protein 3 from Arabidopsis with 71.34% of identity
• Blastx: Casein kinase 1-like protein 3 from Arabidopsis with 74.06% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28880)
• CantataDB: Link to cantataDB annotations (CNT0000756)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019436617.1)
• Pfam: Protein kinase domain (PF00069.24)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;