Protein coding transcript 106785

• Transcript: Ll_transcript_299470
• CDS coordinates: 465-971 (+)
• Peptide sequence: MFEQRPDYGFLKRLFRDLFAREGYEFDFVFDWTILKYQQAQKNRVQPPISPIPGARNSNSNAMPMDVDNHQGHDSERIRSDNATGSGVKTQFASPEVKIWSSENPLNKNTFGEANIPSTSYTPASTSRWNSLKPGLSTEASNPGLGQGRKVGPSSSWMSSLQNMSSSK*
• ORF Type: complete

Annotations of Ll_transcript_299470

• Blastp: Casein kinase 1-like protein 3 from Arabidopsis with 48.8% of identity
• Blastx: Casein kinase 1-like protein 3 from Arabidopsis with 66.55% of identity
• Eggnog: Casein Kinase(ENOG410XPGP)
• Kegg: Link to kegg annotations (AT4G28880)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446348.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;