Protein coding transcript 106796

• Transcript: Ll_transcript_298828
• CDS coordinates: 3-416 (+)
• Peptide sequence: QISKLKGENFRDVRGVLVKDNKVEWDPKVDRVLLASGKPLVPDYAMTFVRGTSPKPFGRLWWDEIVSTVVTRAEPHNQVILHPAQDRVLTIRENARLQGFPDCYKLCGTVKERYIQVGNAVAVPVALALGYTFGLACQ
• ORF Type: internal

Annotations of Ll_transcript_298828

• Blastp: DNA (cytosine-5)-methyltransferase CMT3 from Oryza sativa with 74.1% of identity
• Blastx: DNA (cytosine-5)-methyltransferase CMT3 from Oryza sativa with 74.1% of identity
• Eggnog: Cytosine-specific methyltransferase(COG0270)
• Kegg: Link to kegg annotations (4347954)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422759.1)
• Pfam: C-5 cytosine-specific DNA methylase (PF00145.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;