Protein coding transcript 106799

• Transcript: Ll_transcript_298817
• CDS coordinates: 3-326 (+)
• Peptide sequence: QISKLKGENFRDVRGVLVKDNKVEWDPKVDRVLLASGKPLVPDYAMTFVRGTSLESFGRLWWDEIVSIFVTRAEPHNQIRDSKDVTIQGHPSVTGSVEKGTGEIVEEA
• ORF Type: internal

Annotations of Ll_transcript_298817

• Blastp: DNA (cytosine-5)-methyltransferase 3 from Zea with 67.5% of identity
• Blastx: DNA (cytosine-5)-methyltransferase 3 from Zea with 67.5% of identity
• Eggnog: Cytosine-specific methyltransferase(COG0270)
• Kegg: Link to kegg annotations (542060)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422758.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;