| Transcript | Ll_transcript_298820 |
|---|---|
| CDS coordinates | 3-320 (+) |
| Peptide sequence | PKNKGANFRDLPGVLVKDNKVEWDPKVDRVLLASGKPLVPDYAMTFVRGTSLESFGRLWWDEIVSIFVTRAEPHNQIRDSKDVTIQGHPSVTGSVEKGTGEIVEEA |
| ORF Type | internal |
| Blastp | DNA (cytosine-5)-methyltransferase 3 from Zea with 70.51% of identity |
|---|---|
| Blastx | DNA (cytosine-5)-methyltransferase 3 from Zea with 70.51% of identity |
| Eggnog | Cytosine-specific methyltransferase(COG0270) |
| Kegg | Link to kegg annotations (542060) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019422758.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer