Protein coding transcript 106804

• Transcript: Ll_transcript_298823
• CDS coordinates: 3-509 (+)
• Peptide sequence: PKNKGANFRDLPGVLVKDNKVEWDPKVDRVLLASGKPLVPDYAMTFVRGTSPKPFGRLWWDEIVSTVVTRAEPHNQVILHPAQDRVLTIRENARLQGFPDCYKLSGTVKERYIQVGNAVAVPVALALGYTFGLACQGLSNDKPLTTLPFKYPSCLALSSSPPIHNNDD*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_298823

• Blastp: Putative DNA (cytosine-5)-methyltransferase CMT1 from Arabidopsis with 69.03% of identity
• Blastx: Putative DNA (cytosine-5)-methyltransferase CMT1 from Arabidopsis with 69.03% of identity
• Eggnog: Cytosine-specific methyltransferase(COG0270)
• Kegg: Link to kegg annotations (AT1G80740)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422759.1)
• Pfam: C-5 cytosine-specific DNA methylase (PF00145.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;