Protein coding transcript 106850

• Transcript: Ll_transcript_300911
• CDS coordinates: 2016-2873 (+)
• Peptide sequence: MLLVFLPLASFRRVDSLRYTSALSVGLAVIFVVITAGVATFKFIDGSIGMPRLMPKFTGQESFWKLFTTIPILVTAYICHHNVHPIDNELKDPTHMKSIVRTSLLLCASVYVATSLFGFFLFGDKTLDDVLANFDGDLGIPYGSFLNDVVRVSYGAHLILVFPIVFYSLRLNVDGLLFPHAIPLAFDNQRFYLVTTVLLIFIFLGANFVPSIWDAFQFTGATASVSAAFIFPAAIAIRDTRGFATKKDKRLSWLMILLAISSSTVAISSDLYSIFSSEAGAAART*
• ORF Type: complete

Annotations of Ll_transcript_300911

• Blastp: Amino acid transporter AVT6A from Arabidopsis with 61.15% of identity
• Blastx: Amino acid transporter AVT6A from Arabidopsis with 60% of identity
• Eggnog: amino acid transport(COG0814)
• Kegg: Link to kegg annotations (AT3G30390)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458311.1)
• Pfam: Transmembrane amino acid transporter protein (PF01490.17)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;